GMPPB Antibody (2B5)

Images

 
Western Blot: GMPPB Antibody (2B5) [H00029925-M07] - Analysis of GMPPB expression in HepG2 (Cat # L019V1).
Immunohistochemistry-Paraffin: GMPPB Antibody (2B5) [H00029925-M07] - Analysis of monoclonal antibody to GMPPB on formalin-fixed paraffin-embedded human adrenal gland. Antibody concentration 3 ug/ml
ELISA: GMPPB Antibody (2B5) [H00029925-M07] - Detection limit for recombinant GST tagged GMPPB is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GMPPB Antibody (2B5) Summary

Immunogen
GMPPB (NP_037466, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKALILVGGYGTRLRPLTLSTPKPLVDFCNKPILLHQVEALAAAGVDHVILAVSYMSQVLEKEMKAQEQRLGIRISMSHEEEPLGTAGPLALARDLLSETADPFFVLNSD
Specificity
GMPPB (2B5)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GMPPB
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GMPPB Antibody (2B5)

  • EC 2.7.7.13
  • GDP-mannose pyrophosphorylase BKIAA1851
  • GTP-mannose-1-phosphate guanylyltransferase beta
  • mannose-1-phosphate guanyltransferase beta
  • mannose-1-phosphate guanylyltransferase

Background

This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. The gene encodes two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31583
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02043
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-56415
Species: Hu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-02996
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87826
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-37933
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010049-M01
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
NBP1-87729
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00029925-M07
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for GMPPB Antibody (H00029925-M07) (0)

There are no publications for GMPPB Antibody (H00029925-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GMPPB Antibody (H00029925-M07) (0)

There are no reviews for GMPPB Antibody (H00029925-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GMPPB Antibody (H00029925-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GMPPB Products

Bioinformatics Tool for GMPPB Antibody (H00029925-M07)

Discover related pathways, diseases and genes to GMPPB Antibody (H00029925-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GMPPB

There are no specific blogs for GMPPB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GMPPB Antibody (2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GMPPB
Entrez
Uniprot