GLT25D1 Antibody


Western Blot: GLT25D1 Antibody [NBP2-14619] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GLT25D1 Antibody [NBP2-14619] - Staining of human placenta shows strong cytoplasmic positivity in decidual cells.

Product Details

Reactivity Hu, MouseSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

GLT25D1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVK HPPAEPSRFISAPTKTPD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
GLT25D1 Protein (NBP2-14619PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Alternate Names for GLT25D1 Antibody

  • GLT25D1 glycosyltransferase 25 domain containing 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, ICFlow

Publications for GLT25D1 Antibody (NBP2-14619) (0)

There are no publications for GLT25D1 Antibody (NBP2-14619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLT25D1 Antibody (NBP2-14619) (0)

There are no reviews for GLT25D1 Antibody (NBP2-14619). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLT25D1 Antibody (NBP2-14619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GLT25D1 Antibody Products

GLT25D1 NBP2-14619

Related Products by Gene

Bioinformatics Tool for GLT25D1 Antibody (NBP2-14619)

Discover related pathways, diseases and genes to GLT25D1 Antibody (NBP2-14619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLT25D1 Antibody (NBP2-14619)

Discover more about diseases related to GLT25D1 Antibody (NBP2-14619).

Pathways for GLT25D1 Antibody (NBP2-14619)

View related products by pathway.

PTMs for GLT25D1 Antibody (NBP2-14619)

Learn more about PTMs related to GLT25D1 Antibody (NBP2-14619).

Blogs on GLT25D1

There are no specific blogs for GLT25D1, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol GLT25D1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-14619 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought