GLT25D1 Antibody

Images

 
Western Blot: GLT25D1 Antibody [NBP2-14619] - Analysis in human cell line U-138MG.
Immunohistochemistry-Paraffin: GLT25D1 Antibody [NBP2-14619] - Staining of human cerebral cortex shows no cytoplasmic positivity in neuronal cells as expected.
Immunohistochemistry-Paraffin: GLT25D1 Antibody [NBP2-14619] - Staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: GLT25D1 Antibody [NBP2-14619] - Staining of human lymphoid node shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: GLT25D1 Antibody [NBP2-14619] - Staining of human skin shows moderate cytoplasmic positivity in melanocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLT25D1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVKHPPAEPSRFISAPTKTPD
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COLGALT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLT25D1 Protein (NBP2-14619PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLT25D1 Antibody

  • GLT25D1 glycosyltransferase 25 domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81307
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-15857
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NBP1-90712
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1152
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DGAL30
Species: Hu
Applications: ELISA

Publications for GLT25D1 Antibody (NBP2-14619) (0)

There are no publications for GLT25D1 Antibody (NBP2-14619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLT25D1 Antibody (NBP2-14619) (0)

There are no reviews for GLT25D1 Antibody (NBP2-14619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLT25D1 Antibody (NBP2-14619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLT25D1 Products

Diseases for GLT25D1 Antibody (NBP2-14619)

Discover more about diseases related to GLT25D1 Antibody (NBP2-14619).
 

Pathways for GLT25D1 Antibody (NBP2-14619)

View related products by pathway.

PTMs for GLT25D1 Antibody (NBP2-14619)

Learn more about PTMs related to GLT25D1 Antibody (NBP2-14619).
 

Research Areas for GLT25D1 Antibody (NBP2-14619)

Find related products by research area.

Blogs on GLT25D1

There are no specific blogs for GLT25D1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLT25D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COLGALT1