GLT25D1 Antibody


Western Blot: GLT25D1 Antibody [NBP2-14619] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: GLT25D1 Antibody [NBP2-14619] - Staining of human placenta shows strong cytoplasmic positivity in decidua cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GLT25D1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: FAFSCKQAEVQMYVCNKEEYGFLPVPLRAHSTLQDEAESFMHVQLEVMVK HPPAEPSRFISAPTKTPD
Specificity of human GLT25D1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLT25D1 Protein (NBP2-14619PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GLT25D1 Antibody

  • GLT25D1 glycosyltransferase 25 domain containing 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GLT25D1 Antibody (NBP2-14619) (0)

There are no publications for GLT25D1 Antibody (NBP2-14619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLT25D1 Antibody (NBP2-14619) (0)

There are no reviews for GLT25D1 Antibody (NBP2-14619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLT25D1 Antibody (NBP2-14619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GLT25D1 Products

GLT25D1 NBP2-14619

Bioinformatics Tool for GLT25D1 Antibody (NBP2-14619)

Discover related pathways, diseases and genes to GLT25D1 Antibody (NBP2-14619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLT25D1 Antibody (NBP2-14619)

Discover more about diseases related to GLT25D1 Antibody (NBP2-14619).

Pathways for GLT25D1 Antibody (NBP2-14619)

View related products by pathway.

PTMs for GLT25D1 Antibody (NBP2-14619)

Learn more about PTMs related to GLT25D1 Antibody (NBP2-14619).

Blogs on GLT25D1

There are no specific blogs for GLT25D1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GLT25D1 Antibody and receive a gift card or discount.


Gene Symbol GLT25D1