GKAP1 Recombinant Protein Antigen

Images

 
There are currently no images for GKAP1 Recombinant Protein Antigen (NBP2-62650PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GKAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GKAP1.

Source: E. coli

Amino Acid Sequence: QKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GKAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62650.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GKAP1 Recombinant Protein Antigen

  • cGMP-dependent protein kinase-anchoring protein of 42 kDa
  • FKSG21
  • FLJ25469
  • G kinase anchoring protein 1
  • G kinase-anchoring protein 1
  • GKAP42cGMP-dependent protein kinase anchoring protein 42kDa
  • protein kinase anchoring protein GKAP42

Background

The GKAP1 gene encodes a G kinase-anchoring protein 1 that is thought to be involved in germ cell development as it localizes with the Golgi and recruits cGMP-dependent protein kinase I alpha to the Golgi in the mouse tests. It exists in two isoforms with isoform 1 at a length of 366 amino acids at 42 kDA and isoform 2 is 315 amino acids long at 36 kDa. The GKAP1 gene has been known to interact with other genes FXR2, HBP1, HGS, PRKG1, and UBQLN4. It has been researched regarding its role in different diseases such as leukemia, ataxia, and pancreatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02521
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55747
Species: Hu
Applications: ICC/IF, WB
NBP1-84418
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-55699
Species: Hu
Applications: ICC/IF, WB
NBP3-10310
Species: Hu
Applications: WB
H00001109-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-88751
Species: Hu
Applications: IHC,  IHC-P
NB100-1720
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP3-32886
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1494
Species: Hu, Mu, Rt
Applications: Block, IHC, Simple Western, WB
NBP1-56536
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24531
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-33879
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46134
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15140
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for GKAP1 Recombinant Protein Antigen (NBP2-62650PEP) (0)

There are no publications for GKAP1 Recombinant Protein Antigen (NBP2-62650PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GKAP1 Recombinant Protein Antigen (NBP2-62650PEP) (0)

There are no reviews for GKAP1 Recombinant Protein Antigen (NBP2-62650PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GKAP1 Recombinant Protein Antigen (NBP2-62650PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GKAP1 Products

Blogs on GKAP1

There are no specific blogs for GKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

hnRNP K Antibody
NBP2-24531

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GKAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GKAP1