Recombinant Human Gigaxonin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gigaxonin Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 534-597 of Human GAN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLDTGTNYDYVREFKRSTGTWHHTKPLLPSDLRRTGCAALRIANCKLFRLQLQQGLFRIRVHSP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GAN

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gigaxonin Protein

  • FLJ38059
  • GAN1KLHL16Kelch-like protein 16
  • giant axonal neuropathy (gigaxonin)
  • gigaxonin

Background

GAN - giant axonal neuropathy (gigaxonin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84430
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
H00005073-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Gigaxonin Partial Recombinant Protein (H00008139-Q01) (0)

There are no publications for Gigaxonin Partial Recombinant Protein (H00008139-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gigaxonin Partial Recombinant Protein (H00008139-Q01) (0)

There are no reviews for Gigaxonin Partial Recombinant Protein (H00008139-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gigaxonin Partial Recombinant Protein (H00008139-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gigaxonin Products

Bioinformatics Tool for Gigaxonin Partial Recombinant Protein (H00008139-Q01)

Discover related pathways, diseases and genes to Gigaxonin Partial Recombinant Protein (H00008139-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gigaxonin Partial Recombinant Protein (H00008139-Q01)

Discover more about diseases related to Gigaxonin Partial Recombinant Protein (H00008139-Q01).
 

Pathways for Gigaxonin Partial Recombinant Protein (H00008139-Q01)

View related products by pathway.

PTMs for Gigaxonin Partial Recombinant Protein (H00008139-Q01)

Learn more about PTMs related to Gigaxonin Partial Recombinant Protein (H00008139-Q01).

Blogs on Gigaxonin

There are no specific blogs for Gigaxonin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gigaxonin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAN