GCAP2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GCAP2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GCAP2.
  
  

  Source: E. coli

  Amino Acid Sequence: GQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEGMFRAFDKNG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GUCA1B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68721.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GCAP2 Recombinant Protein Antigen

• DKFZp686E1183
• GCAP 2
• GCAP2guanylate cyclase-activating protein, photoreceptor 2
• guanylate cyclase activator 1B (retina)
• Guanylate cyclase activator 1B
• guanylyl cyclase-activating protein 2
• GUCA2
• RP48

Background

Guanylate cyclase-activating proteins (GCAPs) are calcium binding proteins that belong to the calmodulin superfamily. GCAPs without calcium are responsible for activation of photoreceptor guanylate cyclase during light adaptation. Studies have shown that the addition or subtraction of Ca2+ results in major conformational changes and the activation/deactivation of GCAP 1 and GCAP 2. It has been demonstrated that both GCAP 1 and 2 act on guanylate cyclase similarly and have approximately 50% homology between the two forms. GCAP-1 is predominantly localized in the photoreceptor outer segments, while GCAP 2 is found in retina samples.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: GUCA1B