Recombinant Human GALNT6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GALNT6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 523-622 of Human GALNT6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GALNT6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GALNT6 Protein

  • EC 2.4.1.41
  • GalNAc transferase 6
  • GalNAcT6
  • GALNAC-T6
  • Polypeptide GalNAc transferase 6
  • polypeptide N-acetylgalactosaminyltransferase 6
  • pp-GaNTase 6
  • Protein-UDP acetylgalactosaminyltransferase 6
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6
  • UDP-N-acetyl-alpha-D-galactosamine: polypeptideN-acetylgalactosaminyltransferase 6
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 6 (GalNAc-T6)

Background

GALNT6 - UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7174
Species: Hu
Applications: WB, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-88662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF7140
Species: Hu
Applications: WB, IHC
AF7528
Species: Hu
Applications: WB
NBP1-32394
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GALNT6 Partial Recombinant Protein (H00011226-Q01) (0)

There are no publications for GALNT6 Partial Recombinant Protein (H00011226-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT6 Partial Recombinant Protein (H00011226-Q01) (0)

There are no reviews for GALNT6 Partial Recombinant Protein (H00011226-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALNT6 Partial Recombinant Protein (H00011226-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GALNT6 Products

Bioinformatics Tool for GALNT6 Partial Recombinant Protein (H00011226-Q01)

Discover related pathways, diseases and genes to GALNT6 Partial Recombinant Protein (H00011226-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT6 Partial Recombinant Protein (H00011226-Q01)

Discover more about diseases related to GALNT6 Partial Recombinant Protein (H00011226-Q01).
 

Pathways for GALNT6 Partial Recombinant Protein (H00011226-Q01)

View related products by pathway.

PTMs for GALNT6 Partial Recombinant Protein (H00011226-Q01)

Learn more about PTMs related to GALNT6 Partial Recombinant Protein (H00011226-Q01).

Blogs on GALNT6

There are no specific blogs for GALNT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GALNT6 Antibody
NBP1-86059

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GALNT6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT6