GAGE5 Antibody (8F8) - Azide and BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: GAGE5 Antibody (8F8) [H00002577-M06] - Analysis of monoclonal antibody to GAGE5 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: GAGE5 Antibody (8F8) [H00002577-M06] - Detection limit for recombinant GST tagged GAGE5 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
8F8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

GAGE5 Antibody (8F8) - Azide and BSA Free Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
GAGE5 (NP_001466.1, 28 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAGE5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAGE5 Antibody (8F8) - Azide and BSA Free

  • cancer/testis antigen family 4, member 5
  • CT4.5Cancer/testis antigen 4.5
  • G antigen 5
  • GAGE-5

Background

The GAGE5 gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic pepti

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-20167
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
NBP2-54704
Species: Hu
Applications: IHC,  IHC-P
NBP3-46274
Species: Hu
Applications: ELISA, IHC, WB
NBP3-05152
Species: Hu, Mu
Applications: ICC/IF, WB
H00266740-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NBP3-48264
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
H00004101-M01
Species: Hu
Applications: ELISA, S-ELISA, WB
NBP3-38158
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-41318
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-92653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KO, WB

Publications for GAGE5 Antibody (H00002577-M06) (0)

There are no publications for GAGE5 Antibody (H00002577-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAGE5 Antibody (H00002577-M06) (0)

There are no reviews for GAGE5 Antibody (H00002577-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAGE5 Antibody (H00002577-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAGE5 Antibody (8F8) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol GAGE5
Uniprot