![Immunocytochemistry/Immunofluorescence: GAGE5 Antibody (8F8) [H00002577-M06] - Analysis of monoclonal antibody to GAGE5 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/GAGE5-Antibody-8F8-Immunocytochemistry-Immunofluorescence-H00002577-M06-img0001.jpg "Immunocytochemistry/Immunofluorescence: GAGE5 Antibody (8F8) [H00002577-M06] - Analysis of monoclonal antibody to GAGE5 on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 8F8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | GAGE5 (NP_001466.1, 28 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | GAGE5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | It has been used for ELISA and WB. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: GAGE5 Antibody (8F8) [H00002577-M06] - Detection limit for recombinant GST tagged GAGE5 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/GAGE5-Antibody-8F8-Sandwich-ELISA-H00002577-M06-img0002.jpg "Sandwich ELISA: GAGE5 Antibody (8F8) [H00002577-M06] - Detection limit for recombinant GST tagged GAGE5 is 0.3 ng/ml as a capture antibody.")
