FXC1 Antibody (1A11)

Sandwich ELISA: FXC1 Antibody (1A11) [H00026515-M04] - Detection limit for recombinant GST tagged FXC1 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, S-ELISA
• Clone: 1A11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

FXC1 Antibody (1A11) Summary

• Immunogen: FXC1 (NP_036324.1, 11 a.a. ~ 103 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
• Specificity: FXC1 - fracture callus 1 homolog (rat) (1A11)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TIMM10B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FXC1 Antibody (1A11)

• fracture callus 1 (rat) homolog
• fracture callus 1 homolog (rat)
• Fracture callus protein 1
• FxC1
• TIM10B
• Tim9b
• TIMM10Bmitochondrial import inner membrane translocase subunit Tim9 B
• TIMM9B

Background

FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM10B
• Entrez:
  • 26515(Human)
• Uniprot:
  • NP_036324(Human)