We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

FUS2 Recombinant Protein Antigen

Images

 
There are currently no images for FUS2 Protein (NBP1-89812PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FUS2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAT6.

Source: E. coli

Amino Acid Sequence: PSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NAA80
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89812.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FUS2 Recombinant Protein Antigen

  • FUS-2
  • FUS2EC 2.3.1.-
  • N-acetyltransferase 6 (GCN5-related)
  • N-acetyltransferase 6
  • Protein fus-2
  • Protein fusion-2

Background

Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP3-04411
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-93736
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF756
Species: Mu
Applications: IHC, WB
NBP1-81283
Species: Hu
Applications: IHC,  IHC-P
NBP3-45493
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-00201
Species: Hu
Applications: Flow, ICC/IF, IHC, PEP-ELISA
NB100-2218
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-87561
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-82537
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP3-46063
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP3-41307
Species: Bv, Hu
Applications: Flow, ICC/IF, IHC, WB
NBP2-02939
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, WB
NBP2-61710
Species: Hu, Rt
Applications: ELISA, Flow, WB
AF1615
Species: Mu
Applications: IHC, WB

Publications for FUS2 Protein (NBP1-89812PEP) (0)

There are no publications for FUS2 Protein (NBP1-89812PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUS2 Protein (NBP1-89812PEP) (0)

There are no reviews for FUS2 Protein (NBP1-89812PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FUS2 Protein (NBP1-89812PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FUS2 Products

Research Areas for FUS2 Protein (NBP1-89812PEP)

Find related products by research area.

Blogs on FUS2

There are no specific blogs for FUS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FUS2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA80