FRA10AC1 Antibody (2C4) - Azide and BSA Free

Western Blot: FRA10AC1 Antibody (2C4) [H00118924-M02] - C10orf4 monoclonal antibody (M02), clone 2C4 Analysis of C10orf4 expression in PC-12.

Western Blot: FRA10AC1 Antibody (2C4) [H00118924-M02] - Analysis of C10orf4 expression in transfected 293T cell line by C10orf4 monoclonal antibody (M02), clone 2C4.Lane 1: C10orf4 transfected lysate(37.6 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 2C4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FRA10AC1 Antibody (2C4) - Azide and BSA Free Summary

• Immunogen: C10orf4 (NP_660289, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MHGHGGYDSDFSDDERCGESSKRKKRTVEDDLLLQKPFQKEKHGKVAHKQVAAELLDREEARNRRFHLIAMDAYQRHTKFVNDYILYYGGKKEDFKRLGE
• Specificity: C10orf4 - chromosome 10 open reading frame 4
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FRA10AC1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FRA10AC1 Antibody (2C4) - Azide and BSA Free

• C10orf4fragile site 10q23.3
• chromosome 10 open reading frame 4
• F26C11.1-like
• FRA10A
• fragile site, folic acid type, rare, fra(10)(q23.3) or fra(10)(q24.2) candidate1
• protein FRA10AC1
• rare folic acid-type fragile site, FRA(10)(q23.3), candidate gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FRA10AC1
• Entrez:
  • 118924(Human)
• OMIM:
  • 608866(Human)
• Uniprot:
  • NP_660289(Human)