We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Flamingo homolog 1/CELSR3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Flamingo homolog 1/CELSR3 Protein [H00001951-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Order Details


    • Catalog Number
      H00001951-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Flamingo homolog 1/CELSR3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 71-180 of Human Flamingo homolog 1/CELSR3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CELSR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flamingo homolog 1/CELSR3 GST (N-Term) Protein

  • Cadherin family member 11
  • cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)
  • CDHF11
  • CDHF11RESDA1
  • CELSR3
  • EGFL1
  • EGFL1cadherin EGF LAG seven-pass G-type receptor 3
  • EGF-like protein 1
  • EGF-like-domain, multiple 1
  • epidermal growth factor-like 1
  • Epidermal growth factor-like protein 1
  • Flamingo homolog 1
  • FMI1anchor protein
  • HFMI1
  • KIAA0812
  • MEGF2
  • MEGF2cadherin EGF LAG seven-pass G-type receptor 3, flamingo (Drosophila) homolog
  • multiple EGF-like domains 2
  • Multiple EGF-like domains protein 2
  • Multiple epidermal growth factor-like domains protein 2
  • RESDA1

Background

CELSR3 - cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1943
Species: Bv, Ca, Eq, Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: IHC,  IHC-P
NBP2-55658
Species: Hu
Applications: ICC/IF
NBP2-81771
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF6278
Applications: WB
NBP1-86990
Species: Hu
Applications: ICC/IF, KD, WB
NBP1-52813
Species: Hu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-81938
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-92847
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1131
Applications: ICC, IHC, WB
AF1526
Applications: CyTOF-ready, Flow, IHC, WB

Publications for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01) (0)

There are no publications for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01) (0)

There are no reviews for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flamingo homolog 1/CELSR3 Products

Research Areas for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01)

Find related products by research area.

Blogs on Flamingo homolog 1/CELSR3

There are no specific blogs for Flamingo homolog 1/CELSR3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flamingo homolog 1/CELSR3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CELSR3