Recombinant Human Flamingo homolog 1/CELSR3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Flamingo homolog 1/CELSR3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human CELSR3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CELSR3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flamingo homolog 1/CELSR3 Protein

  • Cadherin family member 11
  • cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)
  • CDHF11
  • CDHF11RESDA1
  • CELSR3
  • EGFL1
  • EGFL1cadherin EGF LAG seven-pass G-type receptor 3
  • EGF-like protein 1
  • EGF-like-domain, multiple 1
  • epidermal growth factor-like 1
  • Epidermal growth factor-like protein 1
  • Flamingo homolog 1
  • FMI1anchor protein
  • HFMI1
  • KIAA0812
  • MEGF2
  • MEGF2cadherin EGF LAG seven-pass G-type receptor 3, flamingo (Drosophila) homolog
  • multiple EGF-like domains 2
  • Multiple EGF-like domains protein 2
  • Multiple epidermal growth factor-like domains protein 2
  • RESDA1

Background

CELSR3 - cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6739
Species: Hu, Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-49512
Species: Hu
Applications: IHC
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB1001
Species: Hu, Mu
Applications: Flow, IHC, CyTOF-ready
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
AF7164
Species: Hu
Applications: WB
NBP1-86990
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
MAB7475
Species: Hu, Rt
Applications: WB
NBP2-24648
Species: Hu, Mu, Rt, Pm
Applications: WB
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-31406
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
645-WN/CF
Species: Hu, Mu
H00001951-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01) (0)

There are no publications for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01) (0)

There are no reviews for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flamingo homolog 1/CELSR3 Products

Bioinformatics Tool for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01)

Discover related pathways, diseases and genes to Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01)

Discover more about diseases related to Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01).
 

Pathways for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01)

View related products by pathway.

PTMs for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01)

Learn more about PTMs related to Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01).
 

Research Areas for Flamingo homolog 1/CELSR3 Partial Recombinant Protein (H00001951-Q01)

Find related products by research area.

Blogs on Flamingo homolog 1/CELSR3

There are no specific blogs for Flamingo homolog 1/CELSR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Wnt-5a
645-WN-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flamingo homolog 1/CELSR3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CELSR3
Entrez