Flamingo homolog 1/CELSR3 Antibody (2F7) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
CELSR3 (NP_001398, 71 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. REDGGPGLGVREPIFVGLRGRRQSARNSRGPPEQPNEELGIEHGVQPLGSRERETGQGPGSVLYWRPEVSSCGRTGPLQRGSLSPGALSSGVPGSGNSSPLPSDFLIRHH |
| Specificity |
CELSR3 - cadherin, EGF LAG seven-pass G-type receptor 3 (flamingo homolog, Drosophila) |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CELSR3 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Flamingo homolog 1/CELSR3 Antibody (2F7)
Background
The protein encoded by this gene is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. The specific function of this particular member has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Eq, Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, KD, WB
Species: Hu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Publications for Flamingo homolog 1/CELSR3 Antibody (H00001951-M01) (0)
There are no publications for Flamingo homolog 1/CELSR3 Antibody (H00001951-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Flamingo homolog 1/CELSR3 Antibody (H00001951-M01) (0)
There are no reviews for Flamingo homolog 1/CELSR3 Antibody (H00001951-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Flamingo homolog 1/CELSR3 Antibody (H00001951-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Flamingo homolog 1/CELSR3 Products
Research Areas for Flamingo homolog 1/CELSR3 Antibody (H00001951-M01)
Find related products by research area.
|
Blogs on Flamingo homolog 1/CELSR3