FKTN Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: HYLSTKNGAGLSKSKGSRIGFDSTQWRAVKKFIMLTSNQNVPVFLIDPLILELINKNFEQVKNTSHGSTSQCKFFCVPRDFTAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPLHYICKLATHAIHLV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FKTN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FKTN Antibody - BSA Free
Background
FKTN genes encode fukutin proteins that in isoform 1 are 461 amino acids long at 54 kDA and at isoform 2 are 430 amino acids long at 49 kDA. These proteins are thought to participate in glycosylation of alpha-dystroglycan/DAG1 as it is probably a glycosyltransferase. Additionally, it may reinforce large a complex surrounding the outside and inside of muscle membranes, further enhancing brain development. FKTN is involved with the CNBP gene. Defects in this gene cause myscular dystrophy-dystroglycanopathy congenital types A4, B4, C4, and cadiomyopathy dilated type 1X. FKTN is also linked to optic atrophy, cleft lip, walker-warburg syndrome, dubowitz syndrome, retinal detachment, and neuronal migration disorders.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow-IC, Flow, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Rt
Applications: BA, BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Publications for FKTN Antibody (NBP1-84707) (0)
There are no publications for FKTN Antibody (NBP1-84707).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FKTN Antibody (NBP1-84707) (0)
There are no reviews for FKTN Antibody (NBP1-84707).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FKTN Antibody (NBP1-84707) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FKTN Products
Research Areas for FKTN Antibody (NBP1-84707)
Find related products by research area.
|
Blogs on FKTN