Recombinant Human FKBP11 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FKBP11 Protein [H00051303-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FKBP11 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-201 of Human FKBP11 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTLRPSLLPLHLLLLLLLSAAVCRAEAGLETESPVRTLQVETLVEPPEPCAEPAAFGDTLHIHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGKRGFPPSVPADAVVQYDVELIALIRANYWLKLVKGILPLVGMAMVPALLGLIGYHLYRKANRPKVSKKKLKEEKRNKSKKK

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FKBP11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
48.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FKBP11 GST (N-Term) Protein

  • 19 kDa FK506-binding protein
  • EC 5.2.1.8
  • FK506 binding protein 11, 19 kDa
  • FK506-binding protein 11
  • FKBP-11
  • FKBP-19
  • FKBP19FK506 binding protein 11 (19 kDa)
  • MGC54182,19 kDa FKBP
  • peptidyl-prolyl cis-trans isomerase FKBP11
  • PPIase FKBP11
  • rotamase

Background

FKBP11 belongs to the FKBP family of peptidyl-prolyl cis/trans isomerases, which catalyze the folding of proline-containing polypeptides. The peptidyl-prolyl isomerase activity of FKBP proteins is inhibited by the immunosuppressant compounds FK506 and rapamycin (Rulten et al., 2006 [PubMed 16596453]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP3-00253
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-38604
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49242
Species: Hu
Applications: IHC, IHC-P, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-87929
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
NBP1-85360
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38905
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13794
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF4174
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-83889
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-83887
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88766
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85921
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00009360-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-30993
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00051303-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FKBP11 Recombinant Protein (H00051303-P01) (0)

There are no publications for FKBP11 Recombinant Protein (H00051303-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP11 Recombinant Protein (H00051303-P01) (0)

There are no reviews for FKBP11 Recombinant Protein (H00051303-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP11 Recombinant Protein (H00051303-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FKBP11 Products

Bioinformatics Tool for FKBP11 Recombinant Protein (H00051303-P01)

Discover related pathways, diseases and genes to FKBP11 Recombinant Protein (H00051303-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP11 Recombinant Protein (H00051303-P01)

Discover more about diseases related to FKBP11 Recombinant Protein (H00051303-P01).
 

Pathways for FKBP11 Recombinant Protein (H00051303-P01)

View related products by pathway.

PTMs for FKBP11 Recombinant Protein (H00051303-P01)

Learn more about PTMs related to FKBP11 Recombinant Protein (H00051303-P01).

Blogs on FKBP11

There are no specific blogs for FKBP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FKBP11 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP11