Fer-1-like protein 6 Antibody

Images

 
Immunohistochemistry: Fer-1-like protein 6 Antibody [NBP2-31004] - Staining of human stomach, lower shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fer-1-like protein 6 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QPGHDISDSLTATESSGAHSSSQDPPADHIYVDVEPPPTVVPDSAQAQPAILVDVPDSSPMLEPEHTPVAQEPPKDGKPKD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FER1L6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fer-1-like protein 6 Protein (NBP2-31004PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fer-1-like protein 6 Antibody

  • C8ORFK23
  • FER1L6
  • Fer-1-Like 6 (C. Elegans)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-94132
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-77279
Species: Hu, Mu
Applications: WB, IP
AF4466
Species: Hu, Mu
Applications: WB
AF6027
Species: Hu
Applications: WB

Publications for Fer-1-like protein 6 Antibody (NBP2-31004) (0)

There are no publications for Fer-1-like protein 6 Antibody (NBP2-31004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fer-1-like protein 6 Antibody (NBP2-31004) (0)

There are no reviews for Fer-1-like protein 6 Antibody (NBP2-31004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fer-1-like protein 6 Antibody (NBP2-31004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fer-1-like protein 6 Products

Bioinformatics Tool for Fer-1-like protein 6 Antibody (NBP2-31004)

Discover related pathways, diseases and genes to Fer-1-like protein 6 Antibody (NBP2-31004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fer-1-like protein 6 Antibody (NBP2-31004)

Discover more about diseases related to Fer-1-like protein 6 Antibody (NBP2-31004).
 

Pathways for Fer-1-like protein 6 Antibody (NBP2-31004)

View related products by pathway.

Blogs on Fer-1-like protein 6

There are no specific blogs for Fer-1-like protein 6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fer-1-like protein 6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FER1L6
Uniprot