Recombinant Human FBXO44 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXO44 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 168 - 255 of Human FBXO44 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PDCGSKYQLCVQLLSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYGPRVTNSSITIGPPLP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXO44

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXO44 Protein

  • FBG3 DKFZp781J0852
  • F-box gene 3
  • F-box only protein 44
  • F-box protein 44
  • F-box protein FBX30
  • F-box/G-domain protein 3
  • FBX30FBX6AFbx44
  • FBX44
  • Fbxo6a
  • MGC14140

Background

FBXO44 - F-box protein 44

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55140
Species: Hu
Applications: ICC/IF
NBP2-16451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-466
Species: Hu, Mu, Rt
Applications: WB
NB100-93569
Species: Hu, Mu, Rt
Applications: WB
NBP1-55046
Species: Hu
Applications: WB
NBP1-86094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-57960
Species: Hu
Applications: ICC/IF
AF8355
Species: Hu
Applications: WB, IHC
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-88219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for FBXO44 Partial Recombinant Protein (H00093611-Q01) (0)

There are no publications for FBXO44 Partial Recombinant Protein (H00093611-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO44 Partial Recombinant Protein (H00093611-Q01) (0)

There are no reviews for FBXO44 Partial Recombinant Protein (H00093611-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXO44 Partial Recombinant Protein (H00093611-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXO44 Products

Bioinformatics Tool for FBXO44 Partial Recombinant Protein (H00093611-Q01)

Discover related pathways, diseases and genes to FBXO44 Partial Recombinant Protein (H00093611-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO44 Partial Recombinant Protein (H00093611-Q01)

Discover more about diseases related to FBXO44 Partial Recombinant Protein (H00093611-Q01).
 

Pathways for FBXO44 Partial Recombinant Protein (H00093611-Q01)

View related products by pathway.

PTMs for FBXO44 Partial Recombinant Protein (H00093611-Q01)

Learn more about PTMs related to FBXO44 Partial Recombinant Protein (H00093611-Q01).

Blogs on FBXO44

There are no specific blogs for FBXO44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXO44 Antibody
NBP1-84728

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXO44 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO44