Recombinant Human FBXL4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXL4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 524-619 of Human FBXL4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:CFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRAVLELNASFPKVFIKKSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL4 Protein

  • FBL5F-box/LRR-repeat protein 4
  • F-box and leucine-rich repeat protein 4FBL4F-box protein FBL4
  • F-box protein FBL4/FBL5

Background

FBXL4 - F-box and leucine-rich repeat protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
H00011026-M01
Species: Hu
Applications: WB, ELISA
H00442206-R02
Species: Hu
NBP1-98474
Species: Hu
Applications: WB

Publications for FBXL4 Partial Recombinant Protein (H00026235-Q01) (0)

There are no publications for FBXL4 Partial Recombinant Protein (H00026235-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL4 Partial Recombinant Protein (H00026235-Q01) (0)

There are no reviews for FBXL4 Partial Recombinant Protein (H00026235-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL4 Partial Recombinant Protein (H00026235-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL4 Products

Bioinformatics Tool for FBXL4 Partial Recombinant Protein (H00026235-Q01)

Discover related pathways, diseases and genes to FBXL4 Partial Recombinant Protein (H00026235-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL4 Partial Recombinant Protein (H00026235-Q01)

Discover more about diseases related to FBXL4 Partial Recombinant Protein (H00026235-Q01).
 

Pathways for FBXL4 Partial Recombinant Protein (H00026235-Q01)

View related products by pathway.

Blogs on FBXL4

There are no specific blogs for FBXL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXL4 Antibody
NBP2-16441

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL4