Recombinant Human FBXL4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FBXL4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 524-619 of Human FBXL4

Source: Wheat Germ

Amino Acid Sequence: CFTRLAHQLPNLQKLFLTANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDNRAVLELNASFPKVFIKKSF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL4 Protein

  • FBL5F-box/LRR-repeat protein 4
  • F-box and leucine-rich repeat protein 4FBL4F-box protein FBL4
  • F-box protein FBL4/FBL5

Background

FBXL4 - F-box and leucine-rich repeat protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-24569
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, Simple Western, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NLS442
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
NBP2-66296
Species: Hu
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
H00442206-R02
Species: Hu
NBP1-02393
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB

Publications for FBXL4 Partial Recombinant Protein (H00026235-Q01) (0)

There are no publications for FBXL4 Partial Recombinant Protein (H00026235-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL4 Partial Recombinant Protein (H00026235-Q01) (0)

There are no reviews for FBXL4 Partial Recombinant Protein (H00026235-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL4 Partial Recombinant Protein (H00026235-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL4 Products

Bioinformatics Tool for FBXL4 Partial Recombinant Protein (H00026235-Q01)

Discover related pathways, diseases and genes to FBXL4 Partial Recombinant Protein (H00026235-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL4 Partial Recombinant Protein (H00026235-Q01)

Discover more about diseases related to FBXL4 Partial Recombinant Protein (H00026235-Q01).
 

Pathways for FBXL4 Partial Recombinant Protein (H00026235-Q01)

View related products by pathway.

Blogs on FBXL4

There are no specific blogs for FBXL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXL4 Antibody
NBP2-16441

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL4