FARS2 Antibody

Images

 
Western Blot: FARS2 Antibody [NBP1-85188] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: FARS2 Antibody [NBP1-85188] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GTPLFSVYDNLSPVVTTWQNFDSLLIPADHPSRKKGDNYYLNRTHMLRAHTSAHQWDLLHAGLDAFLVVGDVYRRDQIDSQHYPIFHQLEAVRLFSKHELFAGIKDGES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FARS2 Protein (NBP1-85188PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FARS2 Antibody

  • dJ236A3.1
  • dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase))
  • dJ520B18.2
  • EC 6.1.1
  • EC 6.1.1.20
  • FARS1dJ236A3.1 (phenylalanine-tRNA synthetase)
  • HSPC320
  • phenylalanine translase
  • phenylalanine tRNA ligase 2, mitochondrial
  • Phenylalanine--tRNA ligase
  • phenylalanine-tRNA synthetase 1 (mitochondrial)
  • phenylalanine-tRNA synthetase 2 (mitochondrial)
  • phenylalanyl-tRNA synthetase 2, mitochondrial
  • phenylalanyl-tRNA synthetase, mitochondrial
  • PheRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45808
Species: Hu
Applications: IHC
NBP1-54653
Species: Hu
Applications: WB
H00006301-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-38035
Species: Hu
Applications: IHC, IHC-P
NBP2-20567
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33807
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP1-82294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13351
Species: Hu, ChHa
Applications: WB, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC
NBP1-85393
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FARS2 Antibody (NBP1-85188) (0)

There are no publications for FARS2 Antibody (NBP1-85188).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FARS2 Antibody (NBP1-85188) (0)

There are no reviews for FARS2 Antibody (NBP1-85188). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FARS2 Antibody (NBP1-85188) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FARS2 Products

Bioinformatics Tool for FARS2 Antibody (NBP1-85188)

Discover related pathways, diseases and genes to FARS2 Antibody (NBP1-85188). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FARS2 Antibody (NBP1-85188)

Discover more about diseases related to FARS2 Antibody (NBP1-85188).
 

Pathways for FARS2 Antibody (NBP1-85188)

View related products by pathway.

PTMs for FARS2 Antibody (NBP1-85188)

Learn more about PTMs related to FARS2 Antibody (NBP1-85188).

Blogs on FARS2

There are no specific blogs for FARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FARS2