FAM210A Antibody

Images

 
Western Blot: FAM210A Antibody [NBP2-13992] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: FAM210A Antibody [NBP2-13992] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: FAM210A Antibody [NBP2-13992] - Staining of human hippocampus shows moderate cytoplasmic positivity in astrocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM210A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QWNVPRTVSRLARRTCLEPHNAGLFGHCQNVKGPLLLYNAESKVVLVQGP QKQWLHLSAAQCVAKERRPLDAHPPQPGVLRHKQGKQHVSFRRVFSSSAT AQGTP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM210A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM210A Protein (NBP2-13992PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM210A Antibody

  • C18orf19
  • chromosome 18 open reading frame 19
  • family with sequence similarity 210, member A
  • HsT2329
  • hypothetical protein LOC125228
  • MGC24180

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86088
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33380
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
AF6150
Species: Mu
Applications: WB
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-13992
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM210A Antibody (NBP2-13992) (0)

There are no publications for FAM210A Antibody (NBP2-13992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM210A Antibody (NBP2-13992) (0)

There are no reviews for FAM210A Antibody (NBP2-13992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM210A Antibody (NBP2-13992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM210A Products

Bioinformatics Tool for FAM210A Antibody (NBP2-13992)

Discover related pathways, diseases and genes to FAM210A Antibody (NBP2-13992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM210A Antibody (NBP2-13992)

Discover more about diseases related to FAM210A Antibody (NBP2-13992).
 

Pathways for FAM210A Antibody (NBP2-13992)

View related products by pathway.

Blogs on FAM210A

There are no specific blogs for FAM210A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM210A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM210A