FAM110C Antibody

Images

 
Western Blot: FAM110C Antibody [NBP2-84878] - Host: Rabbit. Target Name: FAM110C. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM110C Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM110C. Peptide sequence: DSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
FAM110C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM110C Antibody

  • family with sequence similarity 110, member C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56326
Species: Hu
Applications: ICC/IF, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-86720
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NBP1-88809
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-26101
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: PEP-ELISA, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-26101
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: PEP-ELISA, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-84878
Species: Hu
Applications: WB

Publications for FAM110C Antibody (NBP2-84878) (0)

There are no publications for FAM110C Antibody (NBP2-84878).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM110C Antibody (NBP2-84878) (0)

There are no reviews for FAM110C Antibody (NBP2-84878). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM110C Antibody (NBP2-84878) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM110C Products

Bioinformatics Tool for FAM110C Antibody (NBP2-84878)

Discover related pathways, diseases and genes to FAM110C Antibody (NBP2-84878). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for FAM110C Antibody (NBP2-84878)

View related products by pathway.

PTMs for FAM110C Antibody (NBP2-84878)

Learn more about PTMs related to FAM110C Antibody (NBP2-84878).

Blogs on FAM110C

There are no specific blogs for FAM110C, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM110C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM110C