We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

EXOC2 Recombinant Protein Antigen

Images

 
There are currently no images for EXOC2 Protein (NBP1-83786PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

EXOC2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EXOC2.

Source: E. coli

Amino Acid Sequence: IIVTTKSGGRGTSTVSFKLLKPEKIGILDQSAVWVDEMNYYDMRTDRNKGIPPLSLRPANPLGIEIEKSKFSQKDLEMLFHGMSADFTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EXOC2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83786.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EXOC2 Recombinant Protein Antigen

  • exocyst complex component 2
  • Exocyst complex component Sec5
  • FLJ11026
  • SEC5
  • SEC5L1
  • SEC5-like 1 (S. cerevisiae)
  • SEC5-like 1
  • Sec5p

Background

The protein encoded by the EXOC2 gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and the functions of the exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. This interaction has been shown to mediate filopodia formation in fibroblasts. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3204
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP1-97500
Species: Bv, Ca, Ch, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ye
Applications: IB, ICC/IF, IHC,  IHC-P, WB
NBP1-97492
Species: Bv, Ca, Ch, Fi, Gp, Ha, Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-46542
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IP, WB
NB100-94901
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
H00010928-M02
Species: Hu, Xp
Applications: ELISA, ICC/IF, IP, WB
NBP1-85031
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-61831
Species: Hu, Pm, Mu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP2-99472
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP1-86344
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-93790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91444
Species: Hu
Applications: WB
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-34078
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-21731
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-83786PEP
Species: Hu
Applications: AC

Publications for EXOC2 Protein (NBP1-83786PEP) (0)

There are no publications for EXOC2 Protein (NBP1-83786PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EXOC2 Protein (NBP1-83786PEP) (0)

There are no reviews for EXOC2 Protein (NBP1-83786PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EXOC2 Protein (NBP1-83786PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EXOC2 Products

Research Areas for EXOC2 Protein (NBP1-83786PEP)

Find related products by research area.

Blogs on EXOC2

There are no specific blogs for EXOC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EXOC2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EXOC2