Epsin 3 Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human Epsin 3. Peptide sequence: TETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILGE The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EPN3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Epsin 3 Antibody - BSA Free
Background
The EPSN3 gene encodes an epsin-3 protein that in isoform 1 is 632 amino acids long at 68 kDA and in isoform 2 is 208 amino acids long at 23 kDA. EPSN3 participates in endocytosis, germ cell-sertoli cell junction dynamics, and endocytic trafficking of EGFR through interactions with genes EGFR, ERBB4, CSF1R, and LAPTM5. EPSN3 has been linked to basal cell carcinoma and ulcerative colitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, IP, WB
Species: Hu
Applications: WB
Publications for Epsin 3 Antibody (NBP2-84863) (0)
There are no publications for Epsin 3 Antibody (NBP2-84863).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Epsin 3 Antibody (NBP2-84863) (0)
There are no reviews for Epsin 3 Antibody (NBP2-84863).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Epsin 3 Antibody (NBP2-84863) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Epsin 3 Products
Blogs on Epsin 3