EPC1 Antibody

Images

 
Western Blot: EPC1 Antibody [NBP2-86628] - WB Suggested Anti-EPC1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EPC1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EPC1. Peptide sequence: VNKQDKADLIRPKRKYEKKPKVLPSSAAATPQQTSPAALPVFNAKDLNQY The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Porcine (100%), Bovine (100%), Rabbit (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
EPC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EPC1 Antibody

  • DKFZp781P2312
  • enhancer of polycomb 1
  • enhancer of polycomb homolog 1 (Drosophila)
  • enhancer of polycomb homolog 1
  • Epl1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46214
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-71927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
MAB2695
Species: Hu
Applications: WB
NBP2-07996
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1878
Species: Hu, Mu, Rt, Ba
Applications: WB, EM, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-82613
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49536
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-86628
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB

Publications for EPC1 Antibody (NBP2-86628) (0)

There are no publications for EPC1 Antibody (NBP2-86628).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPC1 Antibody (NBP2-86628) (0)

There are no reviews for EPC1 Antibody (NBP2-86628). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EPC1 Antibody (NBP2-86628) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EPC1 Products

Bioinformatics Tool for EPC1 Antibody (NBP2-86628)

Discover related pathways, diseases and genes to EPC1 Antibody (NBP2-86628). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EPC1 Antibody (NBP2-86628)

Discover more about diseases related to EPC1 Antibody (NBP2-86628).
 

Pathways for EPC1 Antibody (NBP2-86628)

View related products by pathway.

PTMs for EPC1 Antibody (NBP2-86628)

Learn more about PTMs related to EPC1 Antibody (NBP2-86628).
 

Research Areas for EPC1 Antibody (NBP2-86628)

Find related products by research area.

Blogs on EPC1

There are no specific blogs for EPC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPC1