EOGT/AER61 Antibody

Images

 
Western Blot: EOGT/AER61 Antibody [NBP1-57931] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EOGT/AER61 Antibody Summary

Immunogen
Synthetic peptides corresponding to C3ORF64 The peptide sequence was selected from the C terminal of C3ORF64. Peptide sequence GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EOGT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C3orf64 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EOGT/AER61 Antibody

  • AER61 glycosyltransferase
  • AER61
  • C3orf64
  • chromosome 3 open reading frame 64
  • EC 2.4
  • EOGT
  • FLJ13078
  • FLJ33770
  • FLJ41219
  • MGC34132

Background

The exact function of C3orf64 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32791
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-57931
Species: Hu
Applications: WB

Publications for EOGT/AER61 Antibody (NBP1-57931) (0)

There are no publications for EOGT/AER61 Antibody (NBP1-57931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EOGT/AER61 Antibody (NBP1-57931) (0)

There are no reviews for EOGT/AER61 Antibody (NBP1-57931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EOGT/AER61 Antibody (NBP1-57931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EOGT/AER61 Products

Bioinformatics Tool for EOGT/AER61 Antibody (NBP1-57931)

Discover related pathways, diseases and genes to EOGT/AER61 Antibody (NBP1-57931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EOGT/AER61 Antibody (NBP1-57931)

Discover more about diseases related to EOGT/AER61 Antibody (NBP1-57931).
 

Pathways for EOGT/AER61 Antibody (NBP1-57931)

View related products by pathway.

Blogs on EOGT/AER61

There are no specific blogs for EOGT/AER61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EOGT/AER61 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EOGT
Entrez
Uniprot