Enamelin Antibody (2C12)

Images

 
Sandwich ELISA: Enamelin Antibody (2C12) [H00010117-M01] - Detection limit for recombinant GST tagged ENAM is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Enamelin Antibody (2C12) Summary

Immunogen
ENAM (NP_114095, 1043 a.a. ~ 1141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQ
Specificity
Reacts with enamelin.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ENAM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Enamelin Antibody (2C12)

  • ADAI
  • AI1C
  • AIH2
  • amelogenesis imperfecta 2, hypocalcification (autosomal dominant)
  • ENAM
  • Enamelin

Background

Dental enamel is a highly mineralized tissue with 85% of its volume occupied by unusually large, highly organized, hydroxyapatite crystals. This highly organized and unusual structure is thought to be rigorously controlled in ameloblasts through the interaction of a number of organic matrix molecules that include enamelin, amelogenin (AMELX; MIM 300391), ameloblastin (AMBN; MIM 601259), tuftelin (TUFT1; MIM 600087), dentine sialophosphoprotein (DSPP; MIM 125485), and a variety of enzymes. Enamelin is the largest protein in the enamel matrix of developing teeth and comprises approximately 5% of total enamel matrix protein.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3026
Species: Mu
Applications: WB
NBP1-87446
Species: Hu, Rt
Applications: WB, IHC, IHC-P
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-15373
Species: Hu, Mu
Applications: WB
NBP1-62322
Species: Hu
Applications: WB
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-92546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-46517
Species: Hu
Applications: WB, IHC
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-24646
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00054959-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-93737
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00010117-M01
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Enamelin Antibody (H00010117-M01) (0)

There are no publications for Enamelin Antibody (H00010117-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Enamelin Antibody (H00010117-M01) (0)

There are no reviews for Enamelin Antibody (H00010117-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Enamelin Antibody (H00010117-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Enamelin Products

Bioinformatics Tool for Enamelin Antibody (H00010117-M01)

Discover related pathways, diseases and genes to Enamelin Antibody (H00010117-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Enamelin Antibody (H00010117-M01)

Discover more about diseases related to Enamelin Antibody (H00010117-M01).
 

Pathways for Enamelin Antibody (H00010117-M01)

View related products by pathway.

PTMs for Enamelin Antibody (H00010117-M01)

Learn more about PTMs related to Enamelin Antibody (H00010117-M01).

Blogs on Enamelin

There are no specific blogs for Enamelin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Enamelin Antibody (2C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol ENAM
Entrez
Uniprot