ELL2 Recombinant Protein Antigen

Images

 
There are currently no images for ELL2 Recombinant Protein Antigen (NBP2-55603PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ELL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to ELL2.

Source: E. coli

Amino Acid Sequence: HLTNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ELL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55603 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for ELL2 Recombinant Protein Antigen

  • ELL-related RNA polymerase II, elongation factor
  • elongation factor, RNA polymerase II, 2
  • RNA polymerase II elongation factor ELL2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP1-88578
Species: Hu
Applications: WB, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP1-92002
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027125-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-03982
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-82116
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00085403-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1566
Species: Hu
Applications: WB, IP
NBP1-84840
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28728
Species: Hu
Applications: IP (-), WB, IHC
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-496
Species: Hu
Applications: WB, IHC-P, IP
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NB100-1800
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P, IP
NBP1-97637
Species: Hu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-81215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55603PEP
Species: Hu
Applications: AC

Publications for ELL2 Recombinant Protein Antigen (NBP2-55603PEP) (0)

There are no publications for ELL2 Recombinant Protein Antigen (NBP2-55603PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELL2 Recombinant Protein Antigen (NBP2-55603PEP) (0)

There are no reviews for ELL2 Recombinant Protein Antigen (NBP2-55603PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for ELL2 Recombinant Protein Antigen (NBP2-55603PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELL2 Products

Bioinformatics Tool for ELL2 Recombinant Protein Antigen (NBP2-55603PEP)

Discover related pathways, diseases and genes to ELL2 Recombinant Protein Antigen (NBP2-55603PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELL2 Recombinant Protein Antigen (NBP2-55603PEP)

Discover more about diseases related to ELL2 Recombinant Protein Antigen (NBP2-55603PEP).
 

Pathways for ELL2 Recombinant Protein Antigen (NBP2-55603PEP)

View related products by pathway.

PTMs for ELL2 Recombinant Protein Antigen (NBP2-55603PEP)

Learn more about PTMs related to ELL2 Recombinant Protein Antigen (NBP2-55603PEP).

Blogs on ELL2

There are no specific blogs for ELL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DEC1 Antibody
NB100-1800
ELL2 Antibody
NBP2-55603

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ELL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ELL2