ELL2 Antibody

Immunocytochemistry/Immunofluorescence: ELL2 Antibody [NBP2-55603] - Staining of human cell line SiHa shows localization to nucleoplasm.

Product Discontinued

ELL2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HLTNRVPPTLNGHLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDSIYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse 84%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ELL2 Antibody

• ELL-related RNA polymerase II, elongation factor
• elongation factor, RNA polymerase II, 2
• RNA polymerase II elongation factor ELL2

Background

ELL2 - elongation factor, RNA polymerase II, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELL2