Recombinant Human EGR2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human EGR2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-77 of Human EGR2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EGR2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human EGR2 Protein

  • AT591
  • CMT1D
  • CMT4E
  • early growth response 2 (Krox-20 homolog, Drosophila)
  • early growth response 2
  • early growth response protein 2
  • EGR-2
  • FLJ14547
  • Krox-20 homolog, Drosophila
  • KROX-20, Drosophila, homolog (early growth response-2)
  • KROX20DKFZp686J1957
  • Zinc finger protein Krox-20

Background

The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBL1-15012
Species: Hu
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-58020
Species: Hu
Applications: ICC/IF
AF2864
Species: Hu
Applications: WB, ICC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-80999
Species: Hu
Applications: IHC, IHC-P
NBP2-19462
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81342
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for EGR2 Partial Recombinant Protein (H00001959-Q01) (0)

There are no publications for EGR2 Partial Recombinant Protein (H00001959-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EGR2 Partial Recombinant Protein (H00001959-Q01) (0)

There are no reviews for EGR2 Partial Recombinant Protein (H00001959-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EGR2 Partial Recombinant Protein (H00001959-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EGR2 Products

Bioinformatics Tool for EGR2 Partial Recombinant Protein (H00001959-Q01)

Discover related pathways, diseases and genes to EGR2 Partial Recombinant Protein (H00001959-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EGR2 Partial Recombinant Protein (H00001959-Q01)

Discover more about diseases related to EGR2 Partial Recombinant Protein (H00001959-Q01).
 

Pathways for EGR2 Partial Recombinant Protein (H00001959-Q01)

View related products by pathway.

PTMs for EGR2 Partial Recombinant Protein (H00001959-Q01)

Learn more about PTMs related to EGR2 Partial Recombinant Protein (H00001959-Q01).
 

Research Areas for EGR2 Partial Recombinant Protein (H00001959-Q01)

Find related products by research area.

Blogs on EGR2

There are no specific blogs for EGR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

EGR2 Antibody
NB110-59723

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human EGR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EGR2