EFHA2 Antibody

Western Blot: EFHA2 Antibody [NBP1-85154] - Analysis in control (vector only transfected HEK293T lysate) and MICU3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: EFHA2 Antibody [NBP1-85154] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Western Blot: EFHA2 Antibody [NBP1-85154] - Analysis in human cell line SCLC-21H.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EFHA2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRS
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFHA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EFHA2 Protein (NBP1-85154PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EFHA2 Antibody

• DKFZp313A0139
• EF hand domain family A2
• EF hand domain family, member A2
• EF-hand domain family, member A2
• EF-hand domain-containing family member A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFHA2