eEF1A1 Antibody - BSA Free

Western Blot: eEF1A1 Antibody [NBP1-52880] - Antibody Titration: 1 ug/ml Human Hela.

Western Blot: eEF1A1 Antibody [NBP1-52880] - HepG2 cell lysate, concentration 2.5 ug/ml.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

eEF1A1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to EEF1A1(eukaryotic translation elongation factor 1 alpha 1) The peptide sequence was selected from the C terminal of EEF1A1 (NP_001393). Peptide sequence IVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EEF1A1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for eEF1A1 Antibody - BSA Free

• CCS3
• CCS-3
• cervical cancer suppressor 3
• CTCL tumor antigen
• EE1A1
• EEF-1
• EEF1A
• eEF1A-1
• EF1AHNGC:16303
• EF1a-like protein
• EF-1-alpha-1
• EF-Tu
• elongation factor 1 alpha subunit
• elongation factor 1-alpha 1
• Elongation factor Tu
• Eukaryotic elongation factor 1 A-1
• eukaryotic translation elongation factor 1 alpha 1
• eukaryotic translation elongation factor 1 alpha 1-like 14
• FLJ25721
• glucocorticoid receptor AF-1 specific elongation factor
• GRAF-1EF
• LENG7
• leukocyte receptor cluster (LRC) member 7
• Leukocyte receptor cluster member 7
• MGC102687
• MGC131894
• MGC16224
• prostate tumor-inducing protein 1
• PTI1
• translation elongation factor 1 alpha 1-like 14

Background

EEF1A1 is an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome.This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas, and the other isoform (alpha 2) is expressed in brain, heart and skeletal muscle. This isoform is identified as an autoantigen in 66% of patients with Felty syndrome. This gene has been found to have multiple copies on many chromosomes, some of which, if not all, represent different pseudogenes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EEF1A1
• Entrez:
  • 1915(Human)
  • 13627(Mouse)
  • 171361(Rat)
• Uniprot:
  • P68104(Human)