Recombinant Human Ebf4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ebf4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 88 of Human EBF4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPSSPPLAAASSMSLPAAAPTTSVFSFSPVNMISAVKQRSAFAPVLRPPSSPPQACPRAHGEGLPDQSFEDSDKFHSPARGLQGLAYS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
EBF4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ebf4 Protein

  • early B-cell factor 4
  • EBF-4
  • olf-1/EBF-like 4
  • transcription factor COE4

Background

EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
AF6116
Species: Hu
Applications: WB, ICC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-80090
Species: Hu
Applications: WB
NB100-56563
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00253738-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84295
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37424
Species: Hu
Applications: WB, ELISA
NBP2-57558
Species: Hu
Applications: ICC/IF
H00057593-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Ebf4 Recombinant Protein (H00057593-P01) (0)

There are no publications for Ebf4 Recombinant Protein (H00057593-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ebf4 Recombinant Protein (H00057593-P01) (0)

There are no reviews for Ebf4 Recombinant Protein (H00057593-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ebf4 Recombinant Protein (H00057593-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ebf4 Products

Bioinformatics Tool for Ebf4 Recombinant Protein (H00057593-P01)

Discover related pathways, diseases and genes to Ebf4 Recombinant Protein (H00057593-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Ebf4

There are no specific blogs for Ebf4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
TLR1 Antibody
NB100-56563
HES5 Antibody
NBP2-41305

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ebf4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EBF4