DTWD1 Antibody


Western Blot: DTWD1 Antibody [NBP2-30570] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: DTWD1 Antibody [NBP2-30570] - Staining of human cell line A-431 shows localization to nucleus, nucleoli & vesicles.
Immunohistochemistry: DTWD1 Antibody [NBP2-30570] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

DTWD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: LCLASQEVLQKAQQSGRSKCLKCGGSRMFYC
Specificity of human DTWD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DTWD1 Protein (NBP2-30570PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for DTWD1 Antibody

  • DTW domain containing 1
  • DTW domain-containing protein 1
  • MDS009
  • MGC111207
  • x 009 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DTWD1 Antibody (NBP2-30570) (0)

There are no publications for DTWD1 Antibody (NBP2-30570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DTWD1 Antibody (NBP2-30570) (0)

There are no reviews for DTWD1 Antibody (NBP2-30570). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DTWD1 Antibody (NBP2-30570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional DTWD1 Products

Bioinformatics Tool for DTWD1 Antibody (NBP2-30570)

Discover related pathways, diseases and genes to DTWD1 Antibody (NBP2-30570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DTWD1 Antibody (NBP2-30570)

Discover more about diseases related to DTWD1 Antibody (NBP2-30570).

Blogs on DTWD1

There are no specific blogs for DTWD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DTWD1 Antibody and receive a gift card or discount.


Gene Symbol DTWD1