DOK2 Recombinant Protein Antigen

Images

 
There are currently no images for DOK2 Recombinant Protein Antigen (NBP2-62652PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DOK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DOK2.

Source: E. coli

Amino Acid Sequence: RPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DOK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62652.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DOK2 Recombinant Protein Antigen

  • docking protein 2
  • docking protein 2, 56kD
  • docking protein 2, 56kDa
  • Dok-2
  • Downstream of tyrosine kinase 2
  • p56(dok-2)
  • p56DOK
  • p56dok-2

Background

Docking proteins interact with receptor tyrosine kinases and mediate particular biological responses using signal transduction. DOK2 acts as a multiple docking protein downstream of receptor or non-receptor tyrosine kinases. By this mechanism it acts to negatively regulate signal transduction and cell proliferation controlled by cytokines in a feedback loop. DOK2 is highly expressed in cells and tissues of hematopoietic origin as well as in lung. Expression of bcr/abl induces additional tyrosine phosphorylation of the DOK1 and DOK2 proteins and their association with Ras-GAP. Thus, it is suspected that DOK association regulates GAP activity toward Ras and that the DOK proteins serve as mediators of bcr-abl signaling. The role of DOK proteins in bcr-abl regulation may also be implicated in chronic myelogenous leukemia (CML), which is characterized by a Philadelphia chromosome translocation t(9;22). Such a mutation would result in a p210-bcr/abl chimeric protein-tyrosine kinase which has been found in many CML cases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82112
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-41185
Species: Hu, Rt
Applications: IHC,  IHC-P, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
AF2554
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-84084
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
MAB2317
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-80959
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46218
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-37490
Species: Hu, Pm, Pm
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, WB
NBP2-02340
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2724
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
AF5414
Species: Hu
Applications: Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB

Publications for DOK2 Recombinant Protein Antigen (NBP2-62652PEP) (0)

There are no publications for DOK2 Recombinant Protein Antigen (NBP2-62652PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOK2 Recombinant Protein Antigen (NBP2-62652PEP) (0)

There are no reviews for DOK2 Recombinant Protein Antigen (NBP2-62652PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DOK2 Recombinant Protein Antigen (NBP2-62652PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DOK2 Products

Research Areas for DOK2 Recombinant Protein Antigen (NBP2-62652PEP)

Find related products by research area.

Blogs on DOK2

There are no specific blogs for DOK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DOK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DOK2