DNAJC8 Antibody - BSA Free

Western Blot: DNAJC8 Antibody [NBP2-87292] - Host: Rabbit. Target Name: DNAJC8. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DNAJC8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNAJC8 Antibody - BSA Free (NBP2-87292) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAJC8. Peptide sequence: REEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRTF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNAJC8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DNAJC8 Antibody - BSA Free

• DnaJ (Hsp40) homolog, subfamily C, member 8
• dnaJ homolog subfamily C member 8
• HSPC331
• SPF31Splicing protein spf31

Background

DjC8 (DnaJ subfamily C member 8) belongs to the Hsp40 (heat shock protein 40) family of proteins that function as co-chaperones to Hsp70.Hsp40 proteins are classified into 3 main subfamilies (A, B, and C). The families are defined by the presence of particular domains which include a highly conserved alpha-helical N-terminal domain termed the J-domain, a glycine/phenylalanine-rich region, a cysteine-rich region, and a C-terminal beta-sheet containing domain. Djc8 is part of subfamily C that bears only the J-domain. DjC8 is also known as splicing protein spf31, and DNAJC8.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNAJC8