DHTKD1 Antibody


Western Blot: DHTKD1 Antibody [NBP2-57835] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunohistochemistry-Paraffin: DHTKD1 Antibody [NBP2-57835] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

DHTKD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNMGKEEASLEEVLVYLNQIYCGQISIETSQLQSQDEKDWFAKRFEELQKETFTTEERKHLSKLMLESQEFDHFLA
Specificity of human DHTKD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DHTKD1 Recombinant Protein Antigen (NBP2-57835PEP)

Reactivity Notes

Mouse 84%, Rat 89%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for DHTKD1 Antibody

  • dehydrogenase E1 and transketolase domain containing 1
  • Dehydrogenase E1 and transketolase domain-containing protein 1
  • DKFZp762M115
  • EC
  • KIAA1630DKFZP762M115
  • MGC3090
  • probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DHTKD1 Antibody (NBP2-57835) (0)

There are no publications for DHTKD1 Antibody (NBP2-57835).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHTKD1 Antibody (NBP2-57835) (0)

There are no reviews for DHTKD1 Antibody (NBP2-57835). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DHTKD1 Antibody (NBP2-57835) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional DHTKD1 Products

Bioinformatics Tool for DHTKD1 Antibody (NBP2-57835)

Discover related pathways, diseases and genes to DHTKD1 Antibody (NBP2-57835). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHTKD1 Antibody (NBP2-57835)

Discover more about diseases related to DHTKD1 Antibody (NBP2-57835).

Pathways for DHTKD1 Antibody (NBP2-57835)

View related products by pathway.

PTMs for DHTKD1 Antibody (NBP2-57835)

Learn more about PTMs related to DHTKD1 Antibody (NBP2-57835).

Blogs on DHTKD1

There are no specific blogs for DHTKD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our DHTKD1 Antibody and receive a gift card or discount.


Gene Symbol DHTKD1