DHTKD1 Antibody

Images

 
Western Blot: DHTKD1 Antibody [NBP2-55215] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: DHTKD1 Antibody [NBP2-55215] - Staining of human cell line MCF7 shows localization to mitochondria.
Immunohistochemistry-Paraffin: DHTKD1 Antibody [NBP2-55215] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DHTKD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ALPLFWRGYQTERGVYGYRPRKPESREPQGALERPPVDHGLARLVTVYCEHGHKAAKINPLFTGQALLENVPEIQALVQTLQGPFHTAGL
Specificity
Specificity of human DHTKD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DHTKD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DHTKD1 Recombinant Protein Antigen (NBP2-55215PEP)

Reactivity Notes

Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for DHTKD1 Antibody

  • dehydrogenase E1 and transketolase domain containing 1
  • Dehydrogenase E1 and transketolase domain-containing protein 1
  • DKFZp762M115
  • EC 1.2.4.2
  • KIAA1630DKFZP762M115
  • MGC3090
  • probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90004
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30896
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-368
Species: Hu, Mu
Applications: WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-57493
Species: Hu, Mu
Applications: WB, IP
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-55215
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DHTKD1 Antibody (NBP2-55215) (0)

There are no publications for DHTKD1 Antibody (NBP2-55215).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DHTKD1 Antibody (NBP2-55215) (0)

There are no reviews for DHTKD1 Antibody (NBP2-55215). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DHTKD1 Antibody (NBP2-55215) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DHTKD1 Products

Bioinformatics Tool for DHTKD1 Antibody (NBP2-55215)

Discover related pathways, diseases and genes to DHTKD1 Antibody (NBP2-55215). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DHTKD1 Antibody (NBP2-55215)

Discover more about diseases related to DHTKD1 Antibody (NBP2-55215).
 

Pathways for DHTKD1 Antibody (NBP2-55215)

View related products by pathway.

PTMs for DHTKD1 Antibody (NBP2-55215)

Learn more about PTMs related to DHTKD1 Antibody (NBP2-55215).

Blogs on DHTKD1

There are no specific blogs for DHTKD1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DHTKD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DHTKD1