![Western Blot: DHTKD1 Antibody [NBP1-84087] - Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize2/DHTKD1-Antibody-Western-Blot-NBP1-84087-img0007.jpg "Western Blot: DHTKD1 Antibody [NBP1-84087] - Analysis in human cell line MCF-7.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EIKSSYYAKLNDHLNNMAHYRPPALNLQAHWQGLAQPEAQITTWSTGVPLDLLRFVGMKSVEVPRELQMHSHLLKTHVQSRMEKMMDG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DHTKD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Protein-Array-NBP3-07157-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP3-07157-img0002.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-54301-img0001.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-54301-img0003.jpg)
---Azide-and-BSA-Free-Immunohistochemistry-Paraffin-NBP2-54301-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-H00009587-M03-img0002.jpg)
-Western-Blot-H00009587-M03-img0004.jpg)
-Sandwich-ELISA-H00009587-M03-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for DHTKD1 Antibody (NBP1-84087)Discover more about diseases related to DHTKD1 Antibody (NBP1-84087).
| Pathways for DHTKD1 Antibody (NBP1-84087)View related products by pathway.
|
PTMs for DHTKD1 Antibody (NBP1-84087)Learn more about PTMs related to DHTKD1 Antibody (NBP1-84087).
| Research Areas for DHTKD1 Antibody (NBP1-84087)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DHTKD1 |
![Immunohistochemistry-Paraffin: DHTKD1 Antibody [NBP1-84087] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.](http://images.novusbio.com/fullsize2/DHTKD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84087-img0002.jpg "Immunohistochemistry-Paraffin: DHTKD1 Antibody [NBP1-84087] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.")
![Western Blot: DHTKD1 Antibody [NBP1-84087] - Analysis in human cell line TD47D.](http://images.novusbio.com/fullsize2/DHTKD1-Antibody-Western-Blot-NBP1-84087-img0008.jpg "Western Blot: DHTKD1 Antibody [NBP1-84087] - Analysis in human cell line TD47D.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")