DGK-zeta Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

DGK-zeta Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DGKZ.
  
  

  Source: E. coli

  Amino Acid Sequence: EHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: DGKZ
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13918.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

  For further blocking peptide related information and a protocol, click here.

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DGK-zeta Recombinant Protein Antigen

• DAGK5
• DAGK6DAG kinase zeta
• DGKZ
• DGKzeta
• DGK-zeta
• diacylglycerol kinase zeta
• diacylglycerol kinase, zeta 104kDa
• diacylglycerol kinase, zeta
• Diglyceride kinase zeta
• EC 2.7.1.107
• hDGKzeta

Background

DGKZ, also known as Diacylglycerol kinase zeta, consists of six isoforms of sizes 124.1 kDa, 104 kDa, 106 kDa, 104.1 kDa, 104.6 kDa, and 101.2 kDa and is involved in regulating the amount of diacylglycerol in signal transduction pathways as a member of the eukaryotic diacylglycerol kinase family. Current research is exploring the effect of the protein on diseases such as malaria, retinoblastoma, cerebritis, bipolar disorder, and cerebral infarction. The protein interacts with RB1, RBL1, RBL2, MAPK6, and GCOM1 while in glycerolipid metabolism, hemostasis, PIP2 hydrolysis, and signal transduction pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DGKZ