DDX11 Antibody - BSA Free

Western Blot: DDX11 Antibody [NBP2-87260] - Host: Rabbit. Target Name: DDX11. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

DDX11 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human DDX11. Peptide sequence: TQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DDX11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DDX11 Antibody - BSA Free

• CHL1CHL1-related helicase gene-1
• CHL1-related protein 1
• CHLR1MGC9335
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (CHL1-like helicase homolog, S.cerevisiae)
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11 (S.cerevisiae CHL1-likehelicase)
• DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 11
• DEAD/H box protein 11
• EC 3.6.1
• EC 3.6.1.23
• EC 3.6.1.7
• EC 3.6.4.13
• hCHLR1
• Keratinocyte growth factor-regulated gene 2 protein
• KRG-2
• KRG2CHL1-like helicase homolog
• MGC133249
• probable ATP-dependent RNA helicase DDX11

Background

DDX11, also known as Probable ATP-dependent RNA helicase DDX11, consists of five isoforms of sizes of 108.3 kDa, 101.7 kDa, 98.7 kDa, 96.1 kDa, and 33 kDa and is involved in cellular proliferation and alteration of RNA secondary structure. Current research is being conducted for diseases and disorders including anemia, carcinoma, malaria, coloboma, and Roberts syndrome. The protein interacts in metabolism of proteins and unfolded protein response pathways with KAT7, FEN1, PCNA, PFN2, and RFC2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DDX11