CYYR1 Antibody

Images

 
Western Blot: CYYR1 Antibody [NBP1-68916] - Rat Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYYR1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Cyyr1 (cysteine/tyrosine-rich 1) The peptide sequence was selected from the middle region of Cyyr1. Peptide sequence FVYAEDCRAQCGKDCRAYCCNGSTPHCCSYYAYIGSILSGTAIAGIVFGI.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYYR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Cyyr1 and was validated on Western blot.
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYYR1 Antibody

  • C21orf95
  • cysteine and tyrosine-rich 1
  • cysteine and tyrosine-rich protein 1
  • cysteine/tyrosine-rich 1
  • Proline-rich domain-containing protein

Background

The function of Cyyr1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF4695
Species: Hu
Applications: WB, IHC, ICC
NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00056937-M01
Species: Hu
Applications: WB, ELISA
NBP2-14729
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBL1-10101
Species: Hu
NBP1-91612
Species: Mu
Applications: WB
NBP2-01340
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for CYYR1 Antibody (NBP1-68916) (0)

There are no publications for CYYR1 Antibody (NBP1-68916).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYYR1 Antibody (NBP1-68916) (0)

There are no reviews for CYYR1 Antibody (NBP1-68916). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYYR1 Antibody (NBP1-68916) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYYR1 Products

Bioinformatics Tool for CYYR1 Antibody (NBP1-68916)

Discover related pathways, diseases and genes to CYYR1 Antibody (NBP1-68916). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYYR1 Antibody (NBP1-68916)

Discover more about diseases related to CYYR1 Antibody (NBP1-68916).
 

Pathways for CYYR1 Antibody (NBP1-68916)

View related products by pathway.

PTMs for CYYR1 Antibody (NBP1-68916)

Learn more about PTMs related to CYYR1 Antibody (NBP1-68916).

Blogs on CYYR1

There are no specific blogs for CYYR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYYR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYYR1
Uniprot