CYYR1 Antibody Summary
| Immunogen |
Synthetic peptides corresponding to Cyyr1 (cysteine/tyrosine-rich 1) The peptide sequence was selected from the middle region of Cyyr1.
Peptide sequence FVYAEDCRAQCGKDCRAYCCNGSTPHCCSYYAYIGSILSGTAIAGIVFGI. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CYYR1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
This is a rabbit polyclonal antibody against Cyyr1 and was validated on Western blot. |
| Theoretical MW |
18 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for CYYR1 Antibody
Background
The function of Cyyr1 remains unknown.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Bv, Ca, Eq, Hu, Ma-Op, Pm
Applications: WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Publications for CYYR1 Antibody (NBP1-68916) (0)
There are no publications for CYYR1 Antibody (NBP1-68916).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CYYR1 Antibody (NBP1-68916) (0)
There are no reviews for CYYR1 Antibody (NBP1-68916).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CYYR1 Antibody (NBP1-68916) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CYYR1 Products
Blogs on CYYR1