Shisa Like 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KIAA1644 Antibody [NBP2-14729] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol & vesicles.
Immunohistochemistry-Paraffin: KIAA1644 Antibody [NBP2-14729] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Shisa Like 1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: CEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYCCNETEFQAVMQAN
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA1644
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Shisa Like 1 Recombinant Protein Antigen (NBP2-14729PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Shisa Like 1 Antibody

  • KIAA1644 KIAA1644

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80831
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85501
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38013
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-93721
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49526
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBL1-10101
Species: Hu
Applications: WB
NBP1-76496
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP2-46439
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87914
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-31660
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC

Publications for Shisa Like 1 Antibody (NBP2-14729) (0)

There are no publications for Shisa Like 1 Antibody (NBP2-14729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Shisa Like 1 Antibody (NBP2-14729) (0)

There are no reviews for Shisa Like 1 Antibody (NBP2-14729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Shisa Like 1 Antibody (NBP2-14729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Shisa Like 1 Products

Diseases for Shisa Like 1 Antibody (NBP2-14729)

Discover more about diseases related to Shisa Like 1 Antibody (NBP2-14729).
 

Pathways for Shisa Like 1 Antibody (NBP2-14729)

View related products by pathway.

Blogs on Shisa Like 1

There are no specific blogs for Shisa Like 1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Shisa Like 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA1644