Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

Western Blot: Cytokeratin 71 Antibody (1D4) [H00112802-M02] - Analysis of KRT71 expression in transfected 293T cell line by KRT71 monoclonal antibody (M02), clone 1D4.Lane 1: KRT71 transfected lysate (Predicted MW: 57.2 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: Cytokeratin 71 Antibody (1D4) [H00112802-M02] - Detection limit for recombinant GST tagged KRT71 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cytokeratin 71 Antibody (1D4) - Azide and BSA Free Summary

• Immunogen: KRT71 (NP_258259.1, 251 a.a. ~ 332 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSIIDEVRTQYEEIALKSKAEAEALYQTKFQELQL
• Specificity: Reacts with keratin 71.
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KRT71
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytokeratin 71 Antibody (1D4) - Azide and BSA Free

• CK-71
• cytokeratin-71
• hK6irs
• hK6irs1
• K6IRS1MGC119390
• K71
• KB34
• Keratin 6 irs
• keratin 71
• keratin, type II cytoskeletal 71
• keratin-71
• KRT6IRS
• KRT6IRS1MGC119391
• Type II inner root sheath-specific keratin-K6irs1
• Type-II keratin Kb34

Background

Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into epithelial keratins and hair keratins. This gene encodes a protein that is expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KRT71
• Entrez:
  • 112802(Human)
• Uniprot:
  • NP_258259(Human)