Recombinant Human Cystatin-8 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cystatin-8 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 32874 of Human CST8 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA

Protein/Peptide Type
Recombinant Protein
Gene
CST8

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cystatin-8 Protein

  • CRESCystatin-related epididymal spermatogenic protein
  • cystatin 8 (cystatin-related epididymal specific)
  • cystatin-8
  • cystatin-related epididymal-specific

Background

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein similar to type 2 cystatins. The protein exhibits highly tissue-specific expression in the reproductive tract, suggesting implicit roles in reproduction. Alternative splicing identified in mouse is suggested in human based on EST evidence but the full-length nature of putative variants has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-09552
Species: Hu
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-31559
Species: Hu
Applications: IHC, IHC-P
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-80944
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2380
Species: Hu
Applications: WB
NBP2-05682
Species: Hu
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cystatin-8 Recombinant Protein (H00010047-P01) (0)

There are no publications for Cystatin-8 Recombinant Protein (H00010047-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cystatin-8 Recombinant Protein (H00010047-P01) (0)

There are no reviews for Cystatin-8 Recombinant Protein (H00010047-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cystatin-8 Recombinant Protein (H00010047-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cystatin-8 Products

Bioinformatics Tool for Cystatin-8 Recombinant Protein (H00010047-P01)

Discover related pathways, diseases and genes to Cystatin-8 Recombinant Protein (H00010047-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cystatin-8 Recombinant Protein (H00010047-P01)

Discover more about diseases related to Cystatin-8 Recombinant Protein (H00010047-P01).
 

Pathways for Cystatin-8 Recombinant Protein (H00010047-P01)

View related products by pathway.

PTMs for Cystatin-8 Recombinant Protein (H00010047-P01)

Learn more about PTMs related to Cystatin-8 Recombinant Protein (H00010047-P01).

Blogs on Cystatin-8

There are no specific blogs for Cystatin-8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cystatin-8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CST8