Cyclophilin C Antibody (1A10)

Images

 
Sandwich ELISA: Cyclophilin C Antibody (1A10) [H00005480-M03] - Detection limit for recombinant GST tagged PPIC is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cyclophilin C Antibody (1A10) Summary

Immunogen
PPIC (AAH02678.1, 1 a.a. - 124 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKL
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPIC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclophilin C Antibody (1A10)

  • Cyclophilin C
  • CYPCMGC3673
  • EC 5.2.1.8
  • parvulin
  • peptidyl-prolyl cis-trans isomerase C
  • peptidylprolyl isomerase C (cyclophilin C)
  • PPIase C
  • Rotamase C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46420
Species: Hu
Applications: WB, IHC
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
46420002
Species: Hu
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP

Publications for Cyclophilin C Antibody (H00005480-M03) (0)

There are no publications for Cyclophilin C Antibody (H00005480-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin C Antibody (H00005480-M03) (0)

There are no reviews for Cyclophilin C Antibody (H00005480-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Cyclophilin C Antibody (H00005480-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclophilin C Products

Bioinformatics Tool for Cyclophilin C Antibody (H00005480-M03)

Discover related pathways, diseases and genes to Cyclophilin C Antibody (H00005480-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclophilin C Antibody (H00005480-M03)

Discover more about diseases related to Cyclophilin C Antibody (H00005480-M03).
 

Pathways for Cyclophilin C Antibody (H00005480-M03)

View related products by pathway.

PTMs for Cyclophilin C Antibody (H00005480-M03)

Learn more about PTMs related to Cyclophilin C Antibody (H00005480-M03).

Blogs on Cyclophilin C

There are no specific blogs for Cyclophilin C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclophilin C Antibody (1A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIC
Uniprot