Cyclophilin A Antibody

Images

 
Western Blot: Cyclophilin A Antibody [H00005478-D01P] - Analysis of PPIA expression in transfected 293T cell line by PPIA polyclonal antibody.Lane 1: PPIA transfected lysate(18.00 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: Cyclophilin A Antibody [H00005478-D01P] - Analysis of antibody to PPIA on HeLa cell. Antibody concentration 20 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cyclophilin A Antibody Summary

Immunogen
PPIA (NP_066953.1, 1 a.a. - 165 a.a.) full-length human protein. MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPIA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cyclophilin A Antibody

  • Cyclophilin A
  • Cyclosporin A-binding protein
  • CYPA
  • CYPAMGC12404
  • CYPH
  • EC 5.2.1.8
  • MGC117158
  • MGC23397
  • peptidyl-prolyl cis-trans isomerase A
  • peptidylprolyl isomerase A (cyclophilin A)
  • PPIA
  • PPIase A
  • Rotamase A
  • Rotamase
  • T cell cyclophilin

Background

This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NB100-56516
Species: Hu, Mu
Applications: WB, IHC
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
MAB3777
Species: Hu, Mu, Rt
Applications: WB
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97587
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP

Publications for Cyclophilin A Antibody (H00005478-D01P) (0)

There are no publications for Cyclophilin A Antibody (H00005478-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin A Antibody (H00005478-D01P) (0)

There are no reviews for Cyclophilin A Antibody (H00005478-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cyclophilin A Antibody (H00005478-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclophilin A Products

Bioinformatics Tool for Cyclophilin A Antibody (H00005478-D01P)

Discover related pathways, diseases and genes to Cyclophilin A Antibody (H00005478-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclophilin A Antibody (H00005478-D01P)

Discover more about diseases related to Cyclophilin A Antibody (H00005478-D01P).
 

Pathways for Cyclophilin A Antibody (H00005478-D01P)

View related products by pathway.

PTMs for Cyclophilin A Antibody (H00005478-D01P)

Learn more about PTMs related to Cyclophilin A Antibody (H00005478-D01P).
 

Research Areas for Cyclophilin A Antibody (H00005478-D01P)

Find related products by research area.

Blogs on Cyclophilin A

There are no specific blogs for Cyclophilin A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cyclophilin A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPIA
Entrez
Uniprot