CTIF Antibody

Images

 
Immunohistochemistry-Paraffin: CTIF Antibody [NBP1-83008] - Staining of human kidney shows strong cytoplasmic positivity in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CTIF Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGFITFLCEVFGTMRSSTGEPFRVLVCPIYTCLRELLQSQDVKEDAVLCCSMELQSTGRLLEEQLPEMMTELLASARDKMLCPSESMLTRSLLLEVIELHANSWNPLTPPITQYYNRTIQKLTA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTIF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CTIF Protein (NBP1-83008PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CTIF Antibody

  • CBP80/20-dependent translation initiation factor
  • KIAA0427Gm672

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24524
Species: Hu, Mu, Rt, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-30627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2538
Species: Hu
Applications: WB, Simple Western, IHC
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-15971
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80964
Species: Hu
Applications: WB, IHC, IHC-P
MAB5170
Species: Hu
Applications: WB, Simple Western, Block

Publications for CTIF Antibody (NBP1-83008) (0)

There are no publications for CTIF Antibody (NBP1-83008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTIF Antibody (NBP1-83008) (0)

There are no reviews for CTIF Antibody (NBP1-83008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CTIF Antibody (NBP1-83008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CTIF Products

Bioinformatics Tool for CTIF Antibody (NBP1-83008)

Discover related pathways, diseases and genes to CTIF Antibody (NBP1-83008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTIF Antibody (NBP1-83008)

Discover more about diseases related to CTIF Antibody (NBP1-83008).
 

Pathways for CTIF Antibody (NBP1-83008)

View related products by pathway.

PTMs for CTIF Antibody (NBP1-83008)

Learn more about PTMs related to CTIF Antibody (NBP1-83008).

Blogs on CTIF

There are no specific blogs for CTIF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CTIF Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTIF