CRYBA2 Antibody

Images

 
Western Blot: CRYBA2 Antibody [H00001412-B02P] - Analysis of CRYBA2 expression in human spleen.
Western Blot: CRYBA2 Antibody [H00001412-B02P] - Analysis of CRYBA2 expression in transfected 293T cell line by CRYBA2 polyclonal antibody. Lane 1: CRYBA2 transfected lysate(21.67 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CRYBA2 Antibody Summary

Immunogen
CRYBA2 (NP_005200.1, 1 a.a. - 197 a.a.) full-length human protein. MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CRYBA2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CRYBA2 Antibody

  • Beta-A2 crystallin
  • beta-crystallin A2
  • crystallin, beta A2
  • eye lens structural protein

Background

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46354
Species: Hu
Applications: WB, IHC, IF
NBP2-07779
Species: Hu
31310002
Species: Hu
Applications: WB, ELISA
NBP1-32557
Species: Hu
Applications: WB
NBP1-84375
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33010
Species: Mu
Applications: WB
H00001415-M02
Species: Hu
Applications: WB, ELISA
H00001414-M03
Species: Hu
Applications: WB, ELISA
NBP2-58661
Species: Hu
Applications: IHC-P
NBP1-32741
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-49196
Species: Hu
Applications: IHC
MAB5695
Species: Hu, Mu
Applications: WB
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58660
Species: Hu
Applications: IHC-P
H00001412-B02P
Species: Hu
Applications: WB

Publications for CRYBA2 Antibody (H00001412-B02P) (0)

There are no publications for CRYBA2 Antibody (H00001412-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRYBA2 Antibody (H00001412-B02P) (0)

There are no reviews for CRYBA2 Antibody (H00001412-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRYBA2 Antibody (H00001412-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CRYBA2 Products

Bioinformatics Tool for CRYBA2 Antibody (H00001412-B02P)

Discover related pathways, diseases and genes to CRYBA2 Antibody (H00001412-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRYBA2 Antibody (H00001412-B02P)

Discover more about diseases related to CRYBA2 Antibody (H00001412-B02P).
 

Pathways for CRYBA2 Antibody (H00001412-B02P)

View related products by pathway.

PTMs for CRYBA2 Antibody (H00001412-B02P)

Learn more about PTMs related to CRYBA2 Antibody (H00001412-B02P).
 

Research Areas for CRYBA2 Antibody (H00001412-B02P)

Find related products by research area.

Blogs on CRYBA2

There are no specific blogs for CRYBA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CRYBA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYBA2
Uniprot