Recombinant Human CRB1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CRB1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 26-134 of Human CRB1

Source: Wheat Germ

Amino Acid Sequence: FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CRB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CRB1 Protein

  • crumbs homolog 1 (Drosophila)
  • LCA8

Background

CRB1 - crumbs homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, ICC
AF7979
Species: Hu, Mu, Rt
Applications: WB
NBP2-01327
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP2-13249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38638
Species: Hu
Applications: WB, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00145226-D01P
Species: Hu
Applications: WB, ELISA
NBP1-91809
Species: Hu
Applications: IHC, IHC-P
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81185
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-31401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP, ICC, IF
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-86759
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83195
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00023418-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CRB1 Partial Recombinant Protein (H00023418-Q01) (0)

There are no publications for CRB1 Partial Recombinant Protein (H00023418-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CRB1 Partial Recombinant Protein (H00023418-Q01) (0)

There are no reviews for CRB1 Partial Recombinant Protein (H00023418-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CRB1 Partial Recombinant Protein (H00023418-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CRB1 Products

Bioinformatics Tool for CRB1 Partial Recombinant Protein (H00023418-Q01)

Discover related pathways, diseases and genes to CRB1 Partial Recombinant Protein (H00023418-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CRB1 Partial Recombinant Protein (H00023418-Q01)

Discover more about diseases related to CRB1 Partial Recombinant Protein (H00023418-Q01).
 

Pathways for CRB1 Partial Recombinant Protein (H00023418-Q01)

View related products by pathway.

PTMs for CRB1 Partial Recombinant Protein (H00023418-Q01)

Learn more about PTMs related to CRB1 Partial Recombinant Protein (H00023418-Q01).

Blogs on CRB1

There are no specific blogs for CRB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CRB1 Antibody
NBP2-56113

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CRB1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CRB1