COPB2 Antibody

Simple Western: COPB2 Antibody [NBP1-88651] - Simple Western lane view shows a specific band for COPB2 in 0.2 mg/ml of RT4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: COPB2 Antibody [NBP1-88651] - Electropherogram image(s) of corresponding Simple Western lane view. COPB2 antibody was used at 1:20 dilution on RT4 lysate(s).

Immunohistochemistry-Paraffin: COPB2 Antibody [NBP1-88651] -Staining of human pancreas shows strong cytoplasmic granular positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: COPB2 Antibody [NBP1-88651] -Staining of human duodenum shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: COPB2 Antibody [NBP1-88651] -Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: COPB2 Antibody [NBP1-88651] -Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Product Discontinued

COPB2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTA
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COPB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:20
  • Western Blot Reported in scientific literature (PMID: 29946045).
• Application Notes: IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for COPB2 Antibody

• beta prime subunit
• Beta'-coat protein
• Beta'-COP
• betaprime-COP
• coatomer protein complex, subunit beta 2 (beta prime)
• coatomer subunit beta'
• p102

Background

May be used for studies on the effects of various agents influencing energy status, on disrupting the Golgi complex, or on altering the activity of G-proteins or small GTP-binding proteins on the cellular localization of beta-COP, and for the immunoaffinity purification of the beta-COP protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for COPB2 Antibody (NBP1-88651)(3)

Publications using NBP1-88651

• Kitao T, Taguchi K, Seto S et al. Legionella Manipulates Non-canonical SNARE Pairing Using a Bacterial Deubiquitinase Cell Rep 2020-09-08 [PMID: 32905772] (IP, ICC/IF, Human)
• Raphemot R, Toro-Moreno M, Lu KY, et al. Discovery of Druggable Host Factors Critical to Plasmodium Liver-Stage Infection Cell Chem Biol 2019-06-12 [PMID: 31257182]
• McCormick D, Lin YT, GreY F. Identification of Host Factors Involved in Human Cytomegalovirus Replication, Assembly, and Egress Using a Two-Step Small Interfering RNA Screen. MBio. 2018-06-26 [PMID: 29946045] (WB, Human)

Bioinformatics

• Gene Symbol: COPB2
• Entrez:
  • 9276(Human)
• Uniprot:
  • P35606(Human)