We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Connexin 62/GJA10 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Connexin 62/GJA10 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-14050PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Connexin 62/GJA10 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GJA10.

Source: E. coli

Amino Acid Sequence: SEGIEDETGPPFHLKKYSVAQQCMICSSLPERISPLQANNQQQVIRVNVPKSKTMWQIPQPRQLEVDPSNGKKDWSEKDQHSGQLHVHSPCPWAGSAGNQHLGQQSDHSSFGLQNTMSQSWLGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GJA10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14050.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Connexin 62/GJA10 Recombinant Protein Antigen

  • Connexin 62
  • Connexin-62
  • Cx62
  • CX62gap junction alpha-10 protein
  • gap junction protein, alpha 10, 62kDa
  • GJA10
  • RP11-63K6.6

Background

Connexins, such as GJA10, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59254
Species: Hu, Mu
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP2-38234
Species: Hu
Applications: IHC,  IHC-P
NBP1-59196
Species: Hu
Applications: WB
NBP1-85047
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
664-LI
Species: Hu
Applications: BA
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-68799
Species: Hu
Applications: IHC,  IHC-P
NB120-13249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-86892
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-14050PEP
Species: Hu
Applications: AC

Publications for Connexin 62/GJA10 Protein (NBP2-14050PEP) (0)

There are no publications for Connexin 62/GJA10 Protein (NBP2-14050PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Connexin 62/GJA10 Protein (NBP2-14050PEP) (0)

There are no reviews for Connexin 62/GJA10 Protein (NBP2-14050PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Connexin 62/GJA10 Protein (NBP2-14050PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Connexin 62/GJA10 Products

Array NBP2-14050PEP

Blogs on Connexin 62/GJA10

There are no specific blogs for Connexin 62/GJA10, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Connexin 62/GJA10 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GJA10